PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_28084A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 116aa    MW: 13191.5 Da    PI: 11.4003
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_28084AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-1466106748
                                HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                 Ede++v+ v+++G++ W+tIa+ ++ gR +kqc++r ++yl
  Oropetium_20150105_28084A  66 HEDEIIVQMVNKYGPKKWSTIAQALP-GRIGKQCRERVRTYL 106
                                69************************.***********9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.72857110IPR017930Myb domain
SMARTSM007173.3E-861108IPR001005SANT/Myb domain
SuperFamilySSF466891.2E-1162108IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-1566107IPR009057Homeodomain-like
PfamPF002493.5E-1267106IPR001005SANT/Myb domain
CDDcd001671.00E-1167106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MTSDKGKVSK RLGRLLELRH LPVKGEPAVS HRSSDRLMGG PLVRQGVQLR GIGRLRRISD  60
VKDKWHEDEI IVQMVNKYGP KKWSTIAQAL PGRIGKQCRE RVRTYLALET DRLMH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB9EUH29e-23B9EUH2_ORYSJ; Uncharacterized protein
STRINGBGIOSGA003060-PA1e-19(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2747622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.23e-17myb domain protein 3r-4